PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c4_17230V3.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 307aa    MW: 32637.2 Da    PI: 9.2845
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c4_17230V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.21.9e-081558344
                       SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
    Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                        WT e d+ + +a + +G +   +W+ Ia+ +  g+ + ++k ++
  Pp3c4_17230V3.3.p 15 VWTREQDKEFENALNTYGEDtpnRWEEIASQVT-GKDAAEVKRHY 58
                       6*******************************9.**********9 PP

2Myb_DNA-binding38.92e-12145189347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +W++eE+ l++ + +++G+g+W++I+r +   Rt+ q+ s+ qky
  Pp3c4_17230V3.3.p 145 PWSEEEHRLFLLGLAKFGKGDWRSISRNFVISRTPTQVASHAQKY 189
                        7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129310.4481166IPR017884SANT domain
SMARTSM007178.8E-91264IPR001005SANT/Myb domain
SuperFamilySSF466898.28E-121469IPR009057Homeodomain-like
PfamPF002491.4E-61558IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-61665IPR009057Homeodomain-like
CDDcd001674.93E-81658No hitNo description
PROSITE profilePS5129416.96137194IPR017930Myb domain
SuperFamilySSF466895.59E-16140195IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-16142192IPR006447Myb domain, plants
SMARTSM007171.1E-10142192IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-11143188IPR009057Homeodomain-like
PfamPF002495.9E-11145189IPR001005SANT/Myb domain
CDDcd001675.80E-10145190No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MADSQSSLTT ASGSVWTREQ DKEFENALNT YGEDTPNRWE EIASQVTGKD AAEVKRHYEI  60
LQEDINLIDS GRIALPSYRF SSLSLSEEGA ASDSPGVKKG ASFSAQVSGP NVNTNGNANG  120
NGNAASGGKG VSSKTSDQER RKGIPWSEEE HRLFLLGLAK FGKGDWRSIS RNFVISRTPT  180
QVASHAQKYF IRLNSINKDK RRSSIHDITS VNNGDAAQQG QGPITGQPGP GSAAGQPIQG  240
GMQSGIYPRQ QMIGQPPAVG APVMLPPPGH VSYGSRGHLP RPVMPGQQIG MAPHMSYPMS  300
QPVCGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-17979474RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.113600.0gametophore
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001779346.11e-174predicted protein
SwissprotQ8S9H74e-61DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA9TL361e-174A9TL36_PHYPA; Predicted protein
STRINGPP1S13_201V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.19e-57MYB family protein